IL-13 (Interleukin-13), Mouse
Interleukin 13 (IL-13) is a protein that in humans is encoded by the IL13 gene. IL-13 was first cloned in 1993 and is located on chromosome 5q31 with a length of 1.4kb. It has a mass of 13 kDa and folds into 4 alpha helical bundles. The secondary structural features of IL-13 are similar to that of Interleukin 4 (IL-4); however it only has 25% sequence homology to IL-4 and is capable of IL-4 independent signaling. IL-13 is a cytokine secreted by T helper type 2 (Th2) cells, CD4 cells, Natural killer T cell, Mast cell, Basophil cells, Eosinophil cells and Nuocyte cells. Interleukin-13 is a central regulator in IgE synthesis, goblet cell hyperplasia, mucus hypersecretion, airway hyperresponsiveness, fibrosis and chitinase up-regulation. It is a mediator of allergic inflammation and different diseases including asthma.
Sequence:
MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFI
TKLLSYTKQLFRHGPF with polyhistidine tag at the C-terminus
UnitProt ID:
P20109
Source:
Escherichia coli
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <4 ng/mL. The specific activity of recombinant mouse IL-13 is > 2.5 x 105 IU/mg.
Purity:
>95% as determined by SDS-PAGE analysis.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice
MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFI
TKLLSYTKQLFRHGPF with polyhistidine tag at the C-terminus
UnitProt ID:
P20109
Source:
Escherichia coli
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <4 ng/mL. The specific activity of recombinant mouse IL-13 is > 2.5 x 105 IU/mg.
Purity:
>95% as determined by SDS-PAGE analysis.
Form:
Lyophilized
Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.
Shipping Conditions:
Blue ice
Chang LC, Chin YC, Wu PC, Wei YF, Wu HC, Cheng TY, Liu YF, Huang CC, Su WP. Polymeric nano-formulation of spectrum selective RTK inhibitor strengthens anti-cancer effects via immune remodeling by endoplasmic reticulum stress-modulating mitochondrial metabolism. Nano Today. Volume 54, 2024, 102070.
Su WP, Chang LC, Song WH, Yang LX, Wang LC, Chia ZC, Chin YC, Shan YS, Huang CC, Yeh CS. Polyaniline-Based Glyco-Condensation on Au Nanoparticles Enhances Immunotherapy in Lung Cancer. ACS Appl Mater Interfaces. 2022 Jun 1;14(21):24144-24159.


